PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G353650.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 175aa    MW: 19800.6 Da    PI: 11.1556
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G353650.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.88.9e-172571348
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                          +WT+eEd +l ++ k+ G g+W+++ar m+  gR++ +c++rw+ +l
  Sobic.004G353650.1.p 25 AWTPEEDARLRRLAKENGFGHWHRVARGMPaPGRSARSCRHRWRHHL 71
                          7******************************************9886 PP

2Myb_DNA-binding26.71.3e-0879121346
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           ++T+ +de l ++v+++G ++Wk + r +  gRt    k rw+ 
  Sobic.004G353650.1.p  79 PFTARDDEELRRLVARHGARRWKDVGRAVY-GRTSRVMKQRWRE 121
                           79***************************9.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.2961975IPR017930Myb domain
SMARTSM007173.9E-132273IPR001005SANT/Myb domain
SuperFamilySSF466892.35E-152481IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-172583IPR009057Homeodomain-like
CDDcd001679.48E-132571No hitNo description
PfamPF002491.2E-142571IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-1075124IPR009057Homeodomain-like
SMARTSM007172.9E-476125IPR001005SANT/Myb domain
PROSITE profilePS5129410.24777127IPR017930Myb domain
CDDcd001679.46E-779122No hitNo description
PfamPF002491.5E-679121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-984121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MEESACSAGA PGTTGIVVRL RLPRAWTPEE DARLRRLAKE NGFGHWHRVA RGMPAPGRSA  60
RSCRHRWRHH LARDVYHRPF TARDDEELRR LVARHGARRW KDVGRAVYGR TSRVMKQRWR  120
EIRETTTATV QQRPGCYYDA DDILASTFAS CNLAMDAMDP RAGSLALGFA CMAV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-14261519135MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-14261519135MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645964.14e-61PREDICTED: myb-related protein B-like
TrEMBLA0A0E0AJ081e-61A0A0E0AJ08_9ORYZ; Uncharacterized protein
STRINGORGLA10G0057400.15e-61(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125692035
Representative plantOGRP10428310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-20myb domain protein r1